現(xiàn)貨供應(yīng),歡迎訂購: : Adiponectin Human Recombinant Catalogue Number | CYT-280 | Synonyms | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. | Introduction | The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced. The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain. Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules. | Patent Rights | The sale and/or commercial use of Recombinant Adiponectin is prohibited in the United States of America (U.S.A). | Description | The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244). | Source | Escherichia Coli. | Physical Appearance | Sterile Filtered clear solution. | Formulation | Acrp30 is liquid 1mg/ml in PBS, pH 7.4 containing 1mM DTT. | Storage | Store Acrp30 at -20°C. Can be stored at 4°C for a limited period of time of 7 days. | Purity | Acrp30 purity is greater than 90% as determined by SDS-PAGE. | Amino Acid Sequence | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGE KGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSV GLETYVTIPNMPIRFTKIFYNNHYDGSTGKFHCNIPGLYYFAYHITVYMKD VKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGE RNGLYADNDNDSTFTGFLLYHDTN. | Usage | ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. | Related Products | |
Related Products Activin A cyt-569 Recombinant Human Activin-A Activin A Plant-Active cyt-414 Recombinant Human Activin-A Active Activin A HEK-Active cyt-078 Recombinant Human Activin-A HEK-Active Activin A Plant cyt-052 Recombinant Human Activin-A, Plant Activin B Active cyt-057 Recombinant Human Activin-B Active Activin B cyt-058 Recombinant Human Activin-B Activin A, Active cyt-145 Recombinant Human Activin-A, Active mActivin A cyt-146 Recombinant Mouse Activin-A rActivin A cyt-147 Recombinant Rat Activin-A Acrp30 cyt-024 Human Adiponectin Acrp30 cyt-280 Recombinant Human Adiponectin Acrp30 His cyt-433 Recombinant Human Adiponectin, His tag mAcrp30 His cyt-537 Recombinant Mouse Adiponectin, His tag Acrp30 HEK cyt-434 Recombinant Human Adiponectin glycosilated, HEK mAcrp30 HEK cyt-435 Recombinant Mouse Adiponectin glycosilated, HEK pAcrp30 HEK cyt-696 Recombinant Porcine Adiponectin glycosilated, HEK Acrp30 Tri cyt-233 Recombinant Human Adiponectin Trimeric Form mAcrp30 Tri cyt-247 Recombinant Mouse Adiponectin Trimeric Form gAcrp30 cyt-615 Recombinant Human Adiponectin Globular gAcrp30 His cyt-277 Recombinant Human Adiponectin Globular, His tag mgAcrp30 cyt-432 Recombinant Mouse Adiponectin Globular AIF1 cyt-697 Recombinant Human Allograft Inflammatory Factor 1 AIF1L cyt-007 Recombinant Human Allograft Inflammatory Factor 1 Like AITRL cyt-076 Recombinant Human AITRL AITRL His cyt-317 Recombinant Human AITRL, His Tag ANGPT1 cyt-074 Recombinant Human Angiopoietin-1 ANGPTL3 cyt-248 Recombinant Human Angiopoietin-like Protein 3 ANGPTL4 cyt-249 Recombinant Human Angiopoietin-like Protein 4 ANGPTL4 HEK cyt-698 Recombinant Human Angiopoietin-like Protein 4, HEK APOA1 cyt-661 Recombinant Human Apolipoprotein A-I APOA1 cyt-037 Human Apolipoprotein A-I APOA2 cyt-038 Human Apolipoprotein A-II APOA5 cyt-025 Recombinant Human Apolipoprotein A-V AREG cyt-041 Recombinant Human Amphiregulin Clusterin cyt-278 Recombinant Human Apoliprotein-J Clusterin cyt-548 Human Apoliprotein-J rClusterin cyt-437 Recombinant Rat Apoliprotein-J k9Clusterin cyt-549 Recombinant Canine Apoliprotein-J k9Clusterin HEK cyt-618 Recombinant Canine Apoliprotein-J HEK APO D cyt-547 Recombinant Human Apoliprotein-D APO D GST cyt-652 Recombinant Human APO-D GST Tag APOH cyt-189 Recombinant Human Apoliprotein-H APOM cyt-715 Recombinant Human Apolipoprotein-M APOM HEK cyt-026 Recombinant Human Apolipoprotein-M, HEK Artemin cyt-306 Recombinant Human Artemin BD 1 cyt-564 Recombinant Human Beta Defensin -1 mBD 1 cyt-044 Recombinant Mouse Beta Defensin -1 rBD 1 cyt-062 Recombinant Rat Beta Defensin -1 BD 2 cyt-571 Recombinant Human Beta Defensin -2 mBD 2 cyt-035 Recombinant Mouse Beta Defensin -2 BD 3 cyt-461 Recombinant Human Beta Defensin -3 mBD 3 cyt-036 Recombinant Mouse Beta Defensin -3 rBD 3 cyt-063 Recombinant Rat Beta Defensin -3 BD 4 cyt-599 Recombinant Human Beta Defensin -4 rBD 4 cyt-066 Recombinant Rat Beta Defensin -4 BDNF cyt-207 Recombinant Human Brain-Derived Neurotrophic Factor proBDNF cyt-014 Recombinant Human Precursor Brain-Derived Neurotrophic Factor BAFF cyt-307 Recombinant Human BAFF (BLyS) BAFF His cyt-545 Recombinant Human BAFF (BLyS), His Tag BAFF Plant cyt-054 Recombinant Human BAFF (BLyS), Plant BAFF R cyt-429 Recombinant Human BAFF (BLyS) Receptor BMPR1A cyt-380 Recombinant Human Bone Morphogenetic protein Receptor-1A BMPR1A HEK cyt-713 Recombinant Human Bone Morphogenetic protein Receptor-1A HEK BMP 2 cyt-261 Recombinant Human Bone Morphogenetic protein-2 BMP 2 HEK cyt-080 Recombinant Human Bone Morphogenetic protein-2, HEK BMP 2 Mono cyt-627 Recombinant Human Bone Morphogenetic protein-2 Monomer Pro BMP 2 cyt-427 Recombinant Human Pro Bone Morphogenetic protein-2 BMP 4 cyt-361 Recombinant Human Bone Morphogenetic protein-4 BMP 4 Active cyt-081 Recombinant Human Bone Morphogenetic protein-4 Active BMP 5 cyt-660 Recombinant Human Bone Morphogenetic protein-5 BMP 7 cyt-333 Recombinant Human Bone Morphogenetic protein-7 BMP 7 His cyt-629 Recombinant Human Bone Morphogenetic protein-7 His Tag BMP 7 CHO cyt-276 Recombinant Human Bone Morphogenetic protein-7, CHO BMP 7 Plant cyt-039 Recombinant Human Bone Morphogenetic protein-7, Plant BMP 7 HEK cyt-082 Recombinant Human Bone Morphogenetic protein-7, HEK b NGF cyt-579 Recombinant Human beta Nerve Growth Factor b NGF CHO cyt-246 Recombinant Human beta Nerve Growth Factor, CHO b NGF HEK cyt-079 Recombinant Human beta Nerve Growth Factor, HEK mb NGF cyt-581 Recombinant Mouse beta Nerve Growth Factor mb NGF cyt-440 Mouse beta Nerve Growth Factor ProNGF cyt-426 Recombinant Human Pro-Nerve Growth Factor BNP cyt-327 Recombinant Human B-type Natriuretic Protein BNP His cyt-605 Recombinant Human B-type Natriuretic Protein His Tag BNP cyt-369 Human B-type Natriuretic Protein BST2 cyt-059 Recombinant Human Bone Marrow Stromal Cell Antigen 2 BTC cyt-330 Recombinant Human Betacellulin BTC His cyt-077 Recombinant Human Betacellulin, His Tag mBTC cyt-131 Recombinant Mouse Betacellulin bBTC cyt-406 Recombinant Bovine Betacellulin CDNF cyt-167 Recombinant Human Cerebral Dopamine Neurotrophic Factor mCDNF cyt-729 Recombinant Mouse Cerebral Dopamine Neurotrophic Factor rCDNF cyt-730 Recombinant Rat Cerebral Dopamine Neurotrophic Factor CLCF1 cyt-071 Recombinant Human Cardiotrophin-Like Cytokine Factor 1 CNTF cyt-272 Recombinant Human Ciliary Neurotrophic Factor CNTF His cyt-573 Recombinant Human Ciliary Neurotrophic Factor, His Tag mCNTF cyt-139 Recombinant Mouse Ciliary Neurotrophic Factor rCNTF cyt-654 Recombinant Rat Ciliary Neurotrophic Factor CT 1 cyt-436 Recombinant Human Cardiotrophin-1 mCT 1 cyt-151 Recombinant Mouse Cardiotrophin-1 rCT 1 cyt-199 Recombinant Rat Cardiotrophin-1 CTGF cyt-541 Recombinant Human Connective Tissue Growth Factor CTGF His cyt-438 Recombinant Human Connective Tissue Growth Factor, His Tag CTGF (182-250 a.a.) cyt-526 Recombinant Human Connective Tissue Growth Factor 182-250 a.a. CTGF HEK cyt-687 Recombinant Human Connective Tissue Growth Factor, HEK CTLA 4 cyt-366 Recombinant Human Cytotoxic T-Lymphocyte Associated Antigen-4 CYR61 cyt-164 Recombinant Human Cysteine-Rich Angiogenic Inducer 61 EBI3 cyt-367 Recombinant Human Epstein Barr Virus Induced 3 EBI3 His cyt-668 Recombinant Human Epstein Barr Virus Induced 3, His Tag mEBI3 cyt-621 Recombinant Mouse Epstein Barr Virus Induced 3 EG VEGF cyt-338 Recombinant Human Endocrine Gland Vacular Endothelial Growth Factor EGF cyt-217 Recombinant Human Epidermal Growth Factor EGF Pichia cyt-332 Recombinant Human Epidermal Growth Factor, Pichia EGF (Leu 21) cyt-466 Recombinant Human Epidermal Growth Factor 21-Leu mEGF cyt-326 Recombinant Mouse Epidermal Growth Factor mEGF cyt-554 Mouse Epidermal Growth Factor mEGF, His cyt-138 Recombinant Mouse Epidermal Growth Factor, His rEGF cyt-556 Rat Epidermal Growth Factor rEGF cyt-669 Recombinant Rat Epidermal Growth Factor EMAP II cyt-607 Recombinant Human Endothelial-Monocyte Activating Polypeptide II AIMP1 cyt-021 Recombinant Human Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 Endoglin Sf9 cyt-389 Recombinant Human Endoglin, Sf9 Endoglin cyt-525 Recombinant Human Endoglin mEndoglin cyt-424 Recombinant Mouse Endoglin EPGN cyt-601 Recombinant Human Epigen EREG cyt-609 Recombinant Human Epiregulin EPO a cyt-201 Recombinant Human Erythropoietin-alpha EPO a Fc cyt-325 Recombinant Human Erythropoietin-alpha Fc/Chimera EPO a HEK cyt-083 Recombinant Human Erythropoietin-alpha, HEK FAS cyt-125 Recombinant Human sFas Receptor FASLG cyt-031 Recombinant Human FAS Ligand FASLG HEK cyt-051 Recombinant Human FAS Ligand, HEK FGF 1 cyt-264 Recombinant Human Fibroblast Growth Factor-acidic FGF 1 Sf9 cyt-364 Recombinant Human Fibroblast Growth Factor-acidic, Sf9 mFGF 1 cyt-528 Recombinant Mouse Fibroblast Growth Factor-acidic mFGF 1 His cyt-072 Recombinant Mouse Fibroblast Growth Factor-acidic, His Tag rFGF 1 cyt-075 Recombinant Rat Fibroblast Growth Factor-acidic baFGF cyt-613 Bovine Fibroblast Growth Factor-acidic FGF 2 cyt-218 Recombinant Human Fibroblast Growth Factor-basic FGF 2 Sf9 cyt-365 Recombinant Human Fibroblast Growth Factor-basic, Sf9 FGF 2 (147 a.a.) cyt-557 Recombinant Human Fibroblast Growth Factor-basic (147 a.a) FGF 2 293 Cells cyt-085 Recombinant Human Fibroblast Growth Factor-basic, 293 Cells FGF2 Plant cyt-123 Recombinant Human Fibroblast Growth Factor-basic, Plant bFGF 2 cyt-288 Recombinant Bovine Fibroblast Growth Factor-basic bFGF 2 cyt-560 Bovine Fibroblast Growth Factor-basic mFGF 2 cyt-386 Recombinant Mouse Fibroblast Growth Factor-basic rFGF 2 cyt-608 Recombinant Rat Fibroblast Growth Factor-basic FGF 4 cyt-312 Recombinant Human Fibroblast Growth Factor-4 FGF 4 HEK cyt-084 Recombinant Human Fibroblast Growth Factor-4, HEK FGF 8 cyt-714 Recombinant Human Fibroblast Growth Factor-8 mFGF 8 cyt-070 Recombinant Mouse Fibroblast Growth Factor-8 FGF 8 HEK cyt-087 Recombinant Human Fibroblast Growth Factor-8, HEK FGF 9 cyt-415 Recombinant Human Fibroblast Growth Factor-9 mFGF 9 cyt-349 Recombinant Mouse Fibroblast Growth Factor-9 rFGF 9 cyt-558 Recombinant Rat Fibroblast Growth Factor-9 FGF12 cyt-620 Recombinant Human Fibroblast Growth Factor 12 FGF13 cyt-121 Recombinant Human Fibroblast Growth Factor 13 mFGF-15 cyt-027 Recombinant Mouse Fibroblast Growth Factor-15 FGF-18 cyt-120 Recombinant Human Fibroblast Growth Factor-18 mFGF-18 cyt-064 Recombinant Mouse Fibroblast Growth Factor-18 rFGF-18 cyt-176 Recombinant Rat Fibroblast Growth Factor-18 FGF 19 cyt-700 Recombinant Human Fibroblast Growth Factor-19 FGF 19 His cyt-279 Recombinant Human Fibroblast Growth Factor-19 His Tag FGF 21 cyt-474 Recombinant Human Fibroblast Growth Factor-21 FGF 21 His cyt-281 Recombinant Human Fibroblast Growth Factor-21, His Tag mFGF 21 cyt-339 Recombinant Mouse Fibroblast Growth Factor-21 mFGF 21 His cyt-516 Recombinant Mouse Fibroblast Growth Factor-21, His Tag rFGF 21 cyt-130 Recombinant Rat Fibroblast Growth Factor-21 bFGF 21 cyt-657 Recombinant Bovine Fibroblast Growth Factor-21 FGF 22 cyt-428 Recombinant Human Fibroblast Growth Factor-22 FGF 23 cyt-020 Recombinant Human Fibroblast Growth Factor-23 FGF 23 His cyt-374 Recombinant Human Fibroblast Growth Factor-23 His Tag FGF 23 C-term cyt-028 Recombinant Human Fibroblast Growth Factor-23 C-Terminal Flt3 Ligand cyt-331 Recombinant Human Flt3-Ligand Flt3 Ligand HEK cyt-706 Recombinant Human Flt3-Ligand, HEK Flt3 Ligand Sf9 cyt-409 Recombinant Human Flt3-Ligand, Sf9 mFlt3 Ligand cyt-340 Recombinant Mouse Flt3-Ligand rmFlt3 Ligand cyt-157 Recombinant Rhesus Macaque Flt3-Ligand FST cyt-232 Recombinant Human Follistatin FST His cyt-029 Recombinant Human Follistatin His Tag mFST cyt-124 Recombinant Mouse Follistatin HB-EGF cyt-119 Recombinant Human Proheparin-Binding EGF-like Growth Factor mHB-EGF cyt-068 Recombinant Mouse Proheparin-Binding EGF-like Growth Factor rHB-EGF cyt-170 Recombinant Rat Proheparin-Binding EGF-like Growth Factor LGALS1 cyt-544 Recombinant Human Galectin-1 mLGALS1 cyt-186 Recombinant Mouse Galectin-1 LGALS2 cyt-725 Recombinant Human Galectin-2 mLGALS2 cyt-019 Recombinant Mouse Galectin-2 LGALS3 cyt-606 Recombinant Human Galectin-3 LGALS3 His cyt-693 Recombinant Human Galectin-3 His Tag mLGALS3 cyt-188 Recombinant Mouse Galectin-3 LGALS4 cyt-686 Recombinant Human Galectin-4 mLGALS4 cyt-187 Recombinant Mouse Galectin-4 LGALS7 cyt-016 Recombinant Human Galectin-7 LGALS7 His cyt-617 Recombinant Human Galectin-7 His Tag mLGALS7 cyt-184 Recombinant Mouse Galectin-7 LGALS8 cyt-017 Recombinant Human Galectin-8 LGALS8 His cyt-727 Recombinant Human Galectin-8, His Tag mLGALS8 cyt-185 Recombinant Mouse Galectin-8 LGALS9 cyt-708 Recombinant Human Galectin-9 mLGALS9 cyt-550 Recombinant Mouse Galectin-9 LGALS13 cyt-004 Recombinant Human Galectin-13 LGALS14 cyt-003 Recombinant Human Galectin-14 LGALSL cyt-073 Recombinant Human Galectin-Related Protein GDNF cyt-305 Recombinant Human Glial-Derived Neurotrophic Factor GDF3 cyt-694 Recombinant Human Growth and Differentiation factor 3 GDF5 cyt-442 Recombinant Human Growth and Differentiation factor 5 GDF5 His cyt-653 Recombinant Human Growth and Differentiation factor 5 His Tag GDF10 cyt-659 Recombinant Human Growth and Differentiation factor 10 GDF15 His cyt-691 Recombinant Human Growth and Differentiation factor 15, His Tag GDF15 D cyt-314 Recombinant Human Growth and Differentiation factor 15 D-Vairant GDF15 cyt-335 Recombinant Human Growth and Differentiation factor 15 G CSF cyt-220 Recombinant Human Granulocyte-Colony Stimulating Factor G CSF His cyt-476 Recombinant Human Granulocyte-Colony Stimulating Factor, His Tag G CSF CHO cyt-329 Recombinant Human Granulocyte-Colony Stimulating Factor, CHO G CSF PEG cyt-018 Recombinant Human Pegylated Granulocyte-Colony Stimulating Factor G CSF HEK cyt-088 Recombinant Human Granulocyte-Colony Stimulating Factor, HEK mG CSF cyt-410 Recombinant Mouse Granulocyte-Colony Stimulating Factor GH cyt-202 Recombinant Human Growth Hormone pGH 22kDa cyt-235 Recombinant Human Placental Corr Growth Hormone GH 20kDa cyt-259 Recombinant Human Pituitary Growth Hormone 20kDa pGH 20kDa cyt-337 Recombinant Human Placental Growth Hormone 20kDa GH Plant cyt-053 Recombinant Human Growth Hormone, Plant GH HEK cyt-091 Recombinant Human Growth Hormone, HEK GHBP cyt-238 Recombinant Human Growth Hormone Binding Protein oGHBP cyt-470 Recombinant Ovine Growth Hormone Binding Protein bGHBP cyt-471 Recombinant Bovine Growth Hormone Binding Protein raGHBP cyt-593 Recombinant Rabbit Growth Hormone Binding Protein chGH cyt-430 Recombinant Chicken Growth Hormone oGH cyt-237 Recombinant Ovine Growth Hormone oGH Placental cyt-594 Recombinant Placental Ovine Growth Hormone bGH cyt-636 Recombinant Bovine Growth Hormone mGH cyt-540 Recombinant Mouse Growth Hormone rGH cyt-296 Recombinant Rat Growth Hormone cGH cyt-297 Recombinant Carp Growth Hormone dGH cyt-498 Recombinant Denis Growth Hormone maiGH cyt-499 Recombinant Mai Mai Growth Hormone sGH cyt-529 Recombinant Gilthead Seabream Growth Hormone raGH cyt-514 Recombinant Rabbit Growth Hormone pGH cyt-519 Recombinant Porcine Growth Hormone chGH Antagonist cyt-538 Recombinant Chicken Growth Hormone Anatagonist oGH Antagonist cyt-215 Recombinant Ovine Growth Hormone Anatagonist zGH cyt-710 Recombinant Zebrafish Growth Hormone zGH Mutant cyt-709 Recombinant Zebrafish Growth Hormone Mutant GM CSF cyt-221 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor GM CSF Pichia cyt-324 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Pichia GM CSF Sf9 cyt-416 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, Sf9 GM CSF HEK cyt-089 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, HEK GM CSF His cyt-477 Recombinant Human Granulocyte Macrophage-Colony Stimulating Factor, His Tag PIXY321 cyt-360 Recombinant Human gm-csf/IL-3 Fusion Protein (PIXY321) mGM CSF cyt-222 Recombinant Mouse Granulocyte Macrophage-Colony Stimulating Factor rGM CSF cyt-395 Recombinant Rat Granulocyte Macrophage-Colony Stimulating Factor pGM CSF cyt-401 Recombinant Porcine Granulocyte Macrophage-Colony Stimulating Factor rmGM CSF cyt-720 Recombinant Rhesus Macaque Granulocyte Macrophage-Colony Stimulating Factor k9GM CSF cyt-724 Recombinant Canine Granulocyte Macrophage-Colony Stimulating Factor GMF b cyt-565 Recombinant Human Glia Maturation Factor Beta GMF b His cyt-726 Recombinant Human Glia Maturation Factor Beta His Tag mGMF b cyt-006 Recombinant Mouse Glia Maturation Factor Beta rGMF b cyt-049 Recombinant Rat Glia Maturation Factor Beta GMFG cyt-632 Recombinant Human Glia Maturation Factor Gamma HDGF cyt-681 Recombinant Human Hepatoma-Derived Growth Factor HDGF2 cyt-132 Recombinant Human Hepatoma-Derived Growth Factor-2 HGF CHO cyt-251 Recombinant Human Hepatocyte Growth Factor, CHO HGF Sf9 cyt-244 Recombinant Human Hepatocyte Growth Factor, Sf9 HGF HEK cyt-090 Recombinant Human Hepatocyte Growth Factor, HEK HGF-A cyt-664 Recombinant Human Hepatocyte Growth Factor A Chain HGF-B cyt-665 Recombinant Human Hepatocyte Growth Factor B Chain pHGF cyt-522 Porcine Hepatocyte Promoting Growth Factor IFI30 cyt-183 Recombinant Human Interferon Gamma-Inducible protein 30 IFN a 1 cyt-291 Recombinant Human Interferon-alpha 1 IFN a 1a cyt-520 Recombinant Human Interferon-alpha 1a IFN a 1b cyt-283 Recombinant Human Interferon-alpha 1b IFN a 2a cyt-204 Recombinant Human Interferon-alpha 2a IFN a 2a Plant cyt-543 Recombinant Human Interferon-alpha 2a, Tobacco IFN a 2b cyt-205 Recombinant Human Interferon-alpha 2b IFN a 2b Yeast cyt-460 Recombinant Human Interferon-alpha 2b, Saccharomyces IFN a 2b 20kd-PEG cyt-034 Recombinant Human Interferon-alpha 2b 20kd-Pegylated IFN a 2b HEK cyt-092 Recombinant Human Interferon-alpha 2b, HEK IFN a 2a HEK cyt-093 Recombinant Human Interferon-alpha 2a, HEK IFNA7 cyt-196 Recombinant Human Interferon-alpha 7 IFNA14 cyt-135 Recombinant Human Interferon-alpha 14 IFN b 1a cyt-236 Recombinant Human Interferon-beta 1a IFN b 1b cyt-234 Recombinant Human Interferon-beta 1b mIFN b His cyt-651 Recombinant Mouse Interferon-beta His Tag IFN g cyt-206 Recombinant Human Interferon-gamma IFN g His cyt-478 Recombinant Human Interferon-gamma His Tag mIFN g cyt-358 Recombinant Mouse Interferon-gamma rIFN g cyt-359 Recombinant Rat Interferon-gamma pIFN g cyt-402 Recombinant Porcine Interferon-gamma qIFN g cyt-739 Recombinant Equine Interferon-gamma IFNW1 cyt-040 Recombinant Human Interferon-Omega 1 oIFN tau cyt-377 Recombinant Ovine Interferon-Tau IRF 1 cyt-449 Recombinant Human Interferon Regulatory Factor-1 IRF 2 cyt-534 Recombinant Human Interferon Regulatory Factor-2 IRF 3 cyt-292 Recombinant Human Interferon Regulatory Factor-3 IGF1 cyt-216 Recombinant Human Insulin Like Growth Factor-1 IGF1 GST cyt-690 Recombinant Human Insulin Like Growth Factor-1, GST-Tag IGF1 Des1-3 cyt-518 Recombinant Human Insulin Like Growth Factor-1 Des (1-3) Long R3 IGF1 cyt-022 Recombinant Human LR3 Insulin Like Growth Factor-1 IGF1 N15 cyt-128 Recombinant Human Insulin Like Growth Factor-1 N15 Labeled mIGF1 cyt-229 Recombinant Mouse Insulin Like Growth Factor-1 rIGF1 cyt-289 Recombinant Rat Insulin Like Growth Factor-1 sIGF1 cyt-295 Recombinant Gilthead Seabream Insulin Like Growth Factor-1 IGF2 cyt-265 Recombinant Human Insulin Like Growth Factor-2 pro-IGF2 cyt-110 Recombinant Human Pro-Insulin Like Growth Factor-2 IGFBP 1 cyt-299 Human Insulin Like Growth Factor Binding Protein-1 IGFBP 3 cyt-300 Recombinant Human Insulin Like Growth Factor Binding Protein-3 IGFBP 4 cyt-030 Recombinant Human Insulin Like Growth Factor Binding Protein-4 IGFBP 5 cyt-464 Recombinant Human Insulin Like Growth Factor Binding Protein-5 IGFBP 6 cyt-258 Recombinant Human Insulin Like Growth Factor Binding Protein-6 IHH cyt-195 Recombinant Human Indian Hedgehog IL 1 alpha cyt-253 Recombinant Human Interleukin-1 alpha IL 1 alpha His cyt-479 Recombinant Human Interleukin-1 alpha, His Tag mIL 1 alpha cyt-523 Recombinant Mouse Interleukin-1 alpha rIL 1 alpha cyt-381 Recombinant Rat Interleukin-1 alpha pIL 1 alpha cyt-396 Recombinant Porcine Interleukin-1 alpha IL 1 beta cyt-208 Recombinant Human Interleukin-1 beta IL 1 beta His cyt-480 Recombinant Human Interleukin-1 beta, His Tag IL 1 beta HEK cyt-094 Recombinant Human Interleukin-1 beta, HEK mIL 1 beta cyt-273 Recombinant Mouse Interleukin-1 beta mIL 1 beta His cyt-578 Recombinant Mouse Interleukin-1 beta, His Tag rIL 1 beta cyt-394 Recombinant Rat Interleukin-1 beta pIL 1 beta cyt-400 Recombinant Porcine Interleukin-1 beta rmIL 1 beta cyt-718 Recombinant Rhesus Macaque Interleukin-1 beta IL 1RA cyt-203 Recombinant Human Interleukin-1 Receptor Antagonist IL 1RA His cyt-481 Recombinant Human Interleukin-1 Receptor Antagonist, His Tag IL1RL1 cyt-671 Recombinant Human Interleukin-1 Receptor Like-1 mIL 1RA cyt-658 Recombinant Mouse Interleukin-1 Receptor Antagonist mIL 1RA His cyt-136 Recombinant Mouse Interleukin-1 Receptor Antagonist, His Tag rIL 1RA cyt-152 Recombinant Rat Interleukin-1 Receptor Antagonist hIL 1RA cyt-010 Recombinant Horse Interleukin-1 Receptor Antagonist IL 2 cyt-209 Recombinant Human Interleukin-2 IL 2 His cyt-666 Recombinant Human Interleukin-2 His Tag IL 2 HEK cyt-095 Recombinant Human Interleukin 2, HEK mIL 2 cyt-370 Recombinant Mouse Interleukin-2 mIL 2 His cyt-624 Recombinant Mouse Interleukin-2, His Tag rIL 2 cyt-382 Recombinant Rat Interleukin-2 pIL 2 cyt-397 Recombinant Porcine Interleukin-2 qIL2 cyt-738 Recombinant Equine Interleukin-2 sIL 2R cyt-285 Recombinant Human Soluble Iinterleukin-2 Receptor alpha IL 3 cyt-210 Recombinant Human Interleukin-3 IL 3 His cyt-482 Recombinant Human Interleukin-3, His Tag IL 3 HEK cyt-096 Recombinant Human Interleukin 3, HEK mIL 3 cyt-371 Recombinant Mouse Interleukin-3 rIL 3 cyt-383 Recombinant Rat Interleukin-3 IL 3 Sf9 cyt-417 Recombinant Human Interleukin-3, Sf9 k9 IL 3 cyt-722 Recombinant Canine Interleukin-3 rmIL3 cyt-156 Recombinant Rhesus Macaque Interleukin-3 IL 4 cyt-211 Recombinant Human Interleukin-4 IL 4 CHO cyt-271 Recombinant Human Interleukin-4 CHO IL 4 His cyt-483 Recombinant Human Interleukin-4, His Tag IL 4 HEK cyt-097 Recombinant Human Interleukin 4, HEK mIL 4 cyt-282 Recombinant Mouse Interleukin-4 rIL 4 cyt-385 Recombinant Rat Interleukin-4 pIL 4 cyt-398 Recombinant Porcine Interleukin-4 rmIL4 cyt-172 Recombinant Rhesus Macaque Interleukin-4 IL 5 cyt-212 Recombinant Human Interleukin-5 mIL 5 cyt-689 Recombinant Mouse Interleukin-5 rIL 5 cyt-387 Recombinant Rat Interleukin-5 IL 6 cyt-213 Recombinant Human Interleukin-6 IL 6 CHO cyt-274 Recombinant Human Interleukin-6, CHO IL 6 His cyt-484 Recombinant Human Interleukin-6, His Tag IL 6 HEK cyt-098 Recombinant Human Interleukin 6, HEK mIL 6 cyt-350 Recombinant Mouse Interleukin-6 rIL 6 cyt-388 Recombinant Rat Interleukin-6 pIL 6 cyt-399 Recombinant Porcine Interleukin-6 rmIL 6 cyt-174 Recombinant Rhesus Macaque Interleukin-6 sIL 6R cyt-286 Recombinant Human Soluble IL-6 Receptor alpha IL 7 cyt-254 Recombinant Human Interleukin-7 IL 7 Yeast cyt-298 Recombinant Human Interleukin-7, Saccharomyces IL 7 His cyt-485 Recombinant Human Interleukin-7, His Tag IL 7, HEK cyt-197 Recombinant Human Interleukin-7, HEK mIL 7 cyt-372 Recombinant Mouse Interleukin-7 rIL 7 cyt-163 Recombinant Rat Interleukin-7 IL 9 cyt-348 Recombinant Human Interleukin-9 IL 9 HEK cyt-099 Recombinant Human Interleukin 9, HEK mIL 9 cyt-373 Recombinant Mouse Interleukin-9 rIL 9 cyt-748 Recombinant Rat Interleukin-9 IL 10 cyt-500 Recombinant Human Interleukin-10 IL 10 His cyt-486 Recombinant Human Interleukin-10, His Tag IL 10 HEK cyt-100 Recombinant Human Interleukin 10, HEK mIL 10 cyt-497 Recombinant Mouse Interleukin-10 rIL 10 cyt-465 Recombinant Rat Interleukin-10 pIL 10 cyt-404 Recombinant Porcine Interleukin-10 IL 11 cyt-214 Recombinant Human Interleukin-11 IL 11 Pichia cyt-013 Recombinant Human Interleukin-11, Pichia mIL 11 cyt-646 Recombinant Mouse Interleukin-11 IL 12 cyt-101 Recombinant Human Interleukin 12 IL 12 p35 His cyt-487 Recombinant Human Interleukin-12 p35, His Tag IL 12 p40 Baculovirus cyt-134 Recombinant Human Interleukin-12 p40, Baculovirus IL 12 p40 His cyt-488 Recombinant Human Interleukin-12 p40, His Tag IL 12 p40 Plant cyt-056 Recombinant Human Interleukin-12 p40, Plant mIL 12 cyt-144 Recombinant Mouse Interleukin-12 rIL 12 cyt-390 Recombinant Rat Interleukin-12 IL 13 cyt-446 Recombinant Human Interleukin-13 IL 13 Variant cyt-682 Recombinant Human Interleukin-13 Variant IL 13 His cyt-489 Recombinant Human Interleukin-13, His Tag mIL 13 cyt-375 Recombinant Mouse Interleukin-13 rIL 13 cyt-391 Recombinant Rat Interleukin-13 rIL 13 109 a.a. cyt-182 Recombinant Rat Interleukin-13 109 a.a. rmIL 13 cyt-175 Recombinant Rhesus Macaque Interleukin-13 IL 15 cyt-230 Recombinant Human Interleukin-15 IL 15 His cyt-490 Recombinant Human Interleukin-15, His Tag mIL 15 cyt-344 Recombinant Mouse Interleukin-15 mIL 15 His cyt-647 Recombinant Mouse Interleukin-15, His Tag rIL 15 cyt-345 Recombinant Rat Interleukin-15 pIL 15 cyt-403 Recombinant Porcine Interleukin-15 IL 16, (130 a.a.) cyt-536 Recombinant Human Interleukin-16, (130 a.a.) IL 16, (121 a.a.) cyt-142 Recombinant Human Interleukin-16, (121 a.a.) IL 16 His cyt-562 Recombinant Human Interleukin-16, His Tag mIL 16 cyt-559 Recombinant Mouse Interleukin-16 maIL 16 cyt-153 Recombinant Rhesus Macaque Interleukin-16 IL 17A cyt-250 Recombinant Human Interleukin-17A IL 17A His cyt-662 Recombinant Human Interleukin-17A His Tag IL 17A HEK cyt-102 Recombinant Human Interleukin 17A, HEK IL 17E cyt-583 Recombinant Human Interleukin-17E IL 17F cyt-587 Recombinant Human Interleukin-17F IL 17F HEK cyt-103 Recombinant Human Interleukin 17F, HEK IL 17 A/F cyt-623 Recombinant Human Interleukin-17 A/F Heterodimer mIL 17 cyt-378 Recombinant Mouse Interleukin-17A mIL 17E cyt-641 Recombinant Mouse Interleukin-17E mIL 17F cyt-642 Recombinant Mouse Interleukin-17F mIL 17 A/F cyt-640 Recombinant Mouse Interleukin-17 A/F Heterodimer rIL 17 A/F cyt-677 Recombinant Rat Interleukin-17 A/F Heterodimer rIL 17 cyt-542 Recombinant Rat Interleukin-17A rIL 17E cyt-576 Recombinant Rat Interleukin-17E rIL 17F cyt-643 Recombinant Rat Interleukin-17F IL 18 cyt-269 Recombinant Human Interleukin-18 IL 18 His cyt-663 Recombinant Human Interleukin-18 His Tag IL18BP cyt-728 Recombinant Human Interleukin-18 Binding Protein mIL 18 cyt-634 Recombinant Mouse Interleukin-18 rIL 18 cyt-376 Recombinant Rat Interleukin-18 IL 19 cyt-363 Recombinant Human Interleukin-19 mIL 19 cyt-411 Recombinant Mouse Interleukin-19 IL 20 cyt-347 Recombinant Human Interleukin-20 mIL 20 cyt-379 Recombinant Mouse Interleukin-20 IL 21 cyt-408 Recombinant Human Interleukin-21 mIL 21 cyt-684 Recombinant Mouse Interleukin-21 rIL 21 cyt-033 Recombinant Rat Interleukin-21 IL 22 cyt-328 Recombinant Human Interleukin-22 mIL 22 cyt-539 Recombinant Mouse Interleukin-22 rIL 22 cyt-173 Recombinant Rat Interleuikin-22 mIL 22 PEG cyt-701 Recombinant Mouse Interleukin-22, Pegylated mIL 22A cyt-148 Recombinant Mouse Interleukin-22 Antagonist (E117A) IL 23 cyt-050 Recombinant Human Interleukin-23 IL 23 His cyt-067 Recombinant Human Interleukin-23, His Tag IL 24 cyt-515 Recombinant Human Interleukin-24 IL 27 cyt-048 Recombinant Human Interleukin-27 p28 mIL 27 cyt-570 Recombinant Mouse Interleukin-27 IL 28A cyt-602 Recombinant Human Interleukin-28A IL 28A HEK cyt-104 Recombinant Human Interleukin-28A, HEK mIL 28A cyt-741 Recombinant Mouse Interleukin-28A IL 28B cyt-105 Recombinant Human Interleukin-28B mIL 28B cyt-732 Recombinant Mouse Interleukin-28B IL 29 cyt-603 Recombinant Human Interleukin-29 IL 29 HEK cyt-117 Recombinant Human Interleukin-29, HEK IL 31 cyt-625 Recombinant Human Interleukin-31 mIL 31 cyt-604 Recombinant Mouse Interleukin-31 IL 32A cyt-584 Recombinant Human IL-32 alpha IL 32A His Tag cyt-648 Recombinant Human IL-32 alpha His Tag IL 33 cyt-425 Recombinant Human Interleukin-33 IL 33 His cyt-667 Recombinant Human Interleukin-33 His Tag mIL 33 cyt-655 Recombinant Mouse Interleukin-33 rIL 33 cyt-150 Recombinant Rat Interleukin-33 IL34 cyt-042 Recombinant Human Interleukin-34 IL36RN cyt-009 Recombinant Human Interleukin-36 Receptor Antagonist mIL36RN cyt-154 Recombinant Mouse Interleukin-36 Receptor Antagonist IL36A cyt-158 Recombinant Human Interleukin-36 Alpha IL36A 158 a.a. cyt-179 Recombinant Human Interleukin-36 Alpha 158 a.a. mIL36A cyt-162 Recombinant Mouse Interleukin-36 Alpha mIL36A 153 a.a. cyt-181 Recombinant Mouse Interleukin-36 Alpha 153 a.a. IL36B cyt-159 Recombinant Human Interleukin-36 Beta IL36B 153 a.a. cyt-180 Recombinant Human Interleukin-36 Beta 153 a.a mIL36B cyt-165 Recombinant Mouse Interleukin-36 Beta IL36G cyt-160 Recombinant Human Interleukin-36 Gamma IL36G 152 a.a. cyt-161 Recombinant Human Interleukin-36 Gamma 152 a.a. mIL36G cyt-745 Recombinant Mouse Interleukin-36 Gamma IL37 cyt-011 Recombinant Human Interleukin 37 IL1F10 cyt-012 Recombinant Human Interleukin 1 Family, Member 10 Insulin cyt-270 Recombinant Human Insulin Insulin Yeast cyt-614 Recombinant Human Insulin Yeast pInsulin cyt-468 Porcine Insulin KGF cyt-219 Recombinant Human Keratinocyte Growth Factor mKGF cyt-721 Recombinant Mouse Keratinocyte Growth Factor KGF HEK cyt-086 Recombinant Human Keratinocyte Growth Factor, HEK KGF 2 cyt-303 Recombinant Human Keratinocyte Growth Factor-2 KGF 2 His cyt-129 Recombinant Human Keratinocyte Growth Factor-2, His Tag mKGF 2 cyt-126 Recombinant Mouse Keratinocyte Growth Factor-2 rKGF cyt-127 Recombinant Rat Keratinocyte Growth Factor-2 Leptin cyt-228 Recombinant Human Leptin Leptin cyt-683 Human Leptin Leptin His cyt-287 Recombinant Human Leptin, His Tag mLeptin cyt-351 Recombinant Mouse Leptin mLeptin PEG cyt-591 Recombinant Pegylated Mouse Leptin rLeptin cyt-227 Recombinant Rat Leptin rLeptin PEG cyt-592 Recombinant Pegylated Rat Leptin oLeptin cyt-239 Recombinant Ovine Leptin oLeptin, MTS cyt-531 Recombinant Ovine Leptin, MTS tag bLeptin cyt-502 Recombinant Bovine Leptin pLeptin cyt-503 Recombinant Porcine Leptin pfLeptin cyt-530 Recombinant Pufferfish Leptin sLeptin cyt-704 Recombinant Salamander Leptin hLeptin cyt-504 Recombinant Horse Leptin chLeptin cyt-505 Recombinant Chicken Leptin dLeptin cyt-506 Recombinant Dog Leptin raLeptin cyt-507 Recombinant Rabbit Leptin Leptin tA cyt-352 Recombinant Human Leptin Triple Antagonist Leptin tA PEG cyt-702 Recombinant Human Leptin Triple Antagonist, Pegylated Leptin qA cyt-353 Recombinant Human Leptin Quadruple Antagonist mLeptin tA cyt-354 Recombinant Mouse Leptin Triple Antagonist mLeptin tA PEG cyt-566 Recombinant Pegylated Mouse Leptin Triple Antagonist, Pegylated rLeptin tA cyt-355 Recombinant Rat Leptin Triple Antagonist rLeptin tA PEG cyt-567 Recombinant Pegylated Rat Leptin Triple Antagonist, Pegylated oLeptin tA cyt-356 Recombinant Ovine Leptin Triple Antagonist oLeptin tA PEG cyt-703 Recombinant Ovine Leptin Triple Antagonist, Pegylated oLeptin qA cyt-357 Recombinant Ovine Leptin Quadruple Antagonist Leptin Receptor cyt-508 Recombinant Human Leptin Binding Domain chLeptin Receptor cyt-509 Recombinant Chicken Leptin Binding Domain LFA 3 cyt-423 Recombinant Human Leukocyte Function Associated Antigen-3 Fusion Protein LIF cyt-644 Recombinant Human Leukemia Inhibitory Factor mLIF cyt-645 Recombinant Mouse Leukemia Inhibitory Factor LIF GST cyt-001 Recombinant Human Leukemia Inhibitory Factor, GST tag rLIF cyt-731 Recombinant Rat Leukemia Inhibitory Factor MANF, His cyt-133 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor, His Tag MANF cyt-141 Recombinant Human Mesencephalic Astrocyte-Derived Neurotrophic Factor M CSF cyt-308 Recombinant Human Macrophage Colony Stimulating Factor M CSF Baculovirus cyt-637 Recombinant Human Macrophage Colony Stimulating Factor, Baculovirus M CSF HEK cyt-106 Recombinant Human Macrophage Colony Stimulating Factor, HEK M CSF His cyt-695 Recombinant Human Macrophage Colony Stimulating Factor, His Tag mM CSF cyt-439 Recombinant Mouse Macrophage Colony Stimulating Factor rM CSF cyt-046 Recombinant Rat Macrophage Colony Stimulating Factor MIF cyt-575 Recombinant Human Macrophage Migration Inhibitor Factor MIF (Active) cyt-596 Recombinant Human Macrophage Migration Inhibitor Factor MIF His N cyt-431 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus MIF His C cyt-521 Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus mMIF cyt-744 Recombinant Mouse Macrophage Migration Inhibitor Factor rMIF cyt-193 Recombinant Rat Macrophage Migration Inhibitor Factor MIA cyt-310 Recombinant Human Melanoma Inhibitory Activity Protein MIA2 cyt-638 Recombinant Human Melanoma Inhibitory Activity Protein 2 Midkine cyt-192 Recombinant Human Midkine Midkine, His cyt-444 Recombinant Human Midkine, His Tag mMidkine cyt-178 Recombinant Mouse Midkine rMidkine cyt-747 Recombinant Rat Midkine MTPN cyt-723 Recombinant Human Myotrophin Myostatin cyt-418 Recombinant Human Myostatin Myostatin His cyt-445 Recombinant Human Myostatin, His-Tag Myostatin Propetide cyt-448 Recombinant Human Myostatin Propeptide Myostatin Plant cyt-055 Recombinant Human Myostatin, Plant NGB cyt-450 Recombinant Human Neuroglobin NRG1 cyt-407 Recombinant Human Neuregulin-1/Heregulin-b2 NRG1 B1 cyt-733 Recombinant Human Neuregulin-1/Heregulin-b1 NRG1 A cyt-736 Recombinant Human Neuregulin-1/Heregulin Alpha (EGF Domain) NT 3 cyt-257 Recombinant Human Neurotrophin-3 proNT3 cyt-015 Recombinant Human Precursor Neurotrophin-3 mNT 3 cyt-688 Recombinant Mouse Neurotrophin-3 NT 4 cyt-626 Recombinant Human Neurotrophin-4 Noggin cyt-475 Recombinant Human Noggin Noggin HEK cyt-107 Recombinant Human Noggin, HEK mNoggin cyt-600 Recombinant Mouse Noggin Omentin cyt-301 Recombinant Human Omentin Omentin His cyt-551 Recombinant Human Omentin His Tag Omentin 298 a.a. cyt-061 Recombinant Human Omentin 298 a.a. OPG Fc cyt-266 Recombinant Human Osteoprotegerin/Fc Chimera OPG cyt-177 Recombinant Human Osteoprotegerin OPG His cyt-290 Recombinant Human Osteoprotegerin, His Tag OPG Hi-5 cyt-633 Recombinant Human Osteoprotegerin Hi-5 OSM cyt-231 Recombinant Human Oncostatin-M OSM (209 a.a.) cyt-639 Recombinant Human Oncostatin-M (209 a.a.) OSM (195 a.a.) cyt-735 Recombinant Human Oncostatin-M (195 a.a.) OSM, His cyt-060 Recombinant Human Oncostatin-M, His Tag OSM HEK cyt-108 Recombinant Human Oncostatin-M, HEK mOSM cyt-168 Recombinant Mouse Oncostatin-M rOSM cyt-169 Recombinant Rat Oncostatin-M OSTF1 cyt-630 Recombinant Human Osteoclast Stimulating Factor-1 OTOR cyt-582 Recombinant Human Otoraplin PDGF AA cyt-341 Recombinant Human Plaet Derived Growth Factor-AA PDGF AA Yeast cyt-568 Recombinant Human Plaet Derived Growth Factor-AA, Yeast PDGF AA HEK cyt-109 Recombinant Human Plaet Derived Growth Factor-AA HEK PDGF A cyt-491 Recombinant Human Plaet Derived Growth Factor-A mPDGF AA cyt-590 Recombinant Mouse Plaet Derived Growth Factor-AA PDGF AB cyt-342 Recombinant Human Plaet Derived Growth Factor-AB PDGF BB cyt-501 Recombinant Human Plaet Derived Growth Factor-BB PDGF B cyt-492 Recombinant Human Plaet Derived Growth Factor-B mPDGF BB cyt-412 Recombinant Mouse Plaet Derived Growth Factor-BB rPDGF BB cyt-740 Recombinant Rat Plaet Derived Growth Factor-BB PDGFD cyt-155 Recombinant Human Plaet Derived Growth Factor-D PDGFRA cyt-065 Recombinant Human Plaet-Derived Growth Factor Receptor, Alpha PEDF cyt-580 Recombinant Human Pigment Epithelium-Derived Factor PEDF His cyt-552 Recombinant Human Pigment Epithelium-Derived Factor, His Tag PEDF HEK cyt-553 Recombinant Human Pigment Epithelium-Derived Factor, HEK Periostin cyt-452 Recombinant Human Periostin PGRN cyt-524 Recombinant Human Progranulin Pleiotrophin cyt-451 Recombinant Human Pleiotrophin Pleiotrophin HEK cyt-198 Recombinant Human Pleiotrophin, HEK Placental Lactogen cyt-656 Recombinant Human Placental Lactogen bPlacental Lactogen cyt-511 Recombinant Bovine Placental Lactogen oPlacental Lactogen cyt-512 Recombinant Ovine Placental Lactogen cPlacental Lactogen cyt-510 Recombinant Caprine Placental Lactogen PLGF 1 cyt-419 Recombinant Human Placenta Growth Factor-1 PLGF 2 cyt-420 Recombinant Human Placenta Growth Factor-2 Prolactin cyt-267 Recombinant Human Prolactin Prolactin His cyt-493 Recombinant Human Prolactin, His Tag mProlactin cyt-321 Recombinant Mouse Prolactin rProlactin cyt-322 Recombinant Rat Prolactin oProlactin cyt-240 Recombinant Ovine Prolactin raProlactin cyt-513 Recombinant Rabbit Prolactin Prl R, GST cyt-469 Recombinant Human Prolactin Receptor , GST Tag Prl R cyt-595 Recombinant Human Prolactin Receptor raPrl R cyt-268 Recombinant Rabbit Prolactin Soluble Receptor oPrl R cyt-293 Recombinant Ovine Prolactin Soluble Receptor bPrl R cyt-294 Recombinant Bovine Prolactin Soluble Receptor tPrl R cyt-532 Recombinant Raibow Trout Prolactin Soluble Receptor rPrl R cyt-533 Recombinant Rat Prolactin Soluble Receptor oPrl A cyt-311 Recombinant Ovine Prolactin Antagonist oPrl A Mutant cyt-705 Recombinant Ovine Prolactin Antagonist, Mutant sCD4 cyt-304 Recombinant Human Soluble CD4 CD4 (26-226) cyt-313 Recombinant Human CD4 (26-226) CD4 (125-202) cyt-315 Recombinant Human CD4 (125-202) CD4 (203-317) cyt-316 Recombinant Human CD4 (203-317) sCD40L cyt-245 Recombinant Human soluble CD40 Ligand/TRAP sCD40L His cyt-670 Recombinant Human soluble CD40 Ligand/TRAP His Tag msCD40L cyt-472 Recombinant Mouse soluble CD40 Ligand/TRAP SCGB1A1 cyt-743 Recombinant Human Uteroglobin mSCGB1A1 cyt-746 Recombinant Mouse Uteroglobin SHH cyt-676 Recombinant Human Sonic HedgeHog SHH, His cyt-717 Recombinant Human Sonic HedgeHog, His Tag mSHH cyt-597 Recombinant Mouse Sonic HedgeHog mSHH, His cyt-711 Recombinant Mouse Sonic HedgeHog, His Tag DHH cyt-467 Recombinant Human Desert HedgeHog DHH (C23II) cyt-362 Recombinant Human Desert HedgeHog (C23II) sRANKL cyt-334 Recombinant Human Soluble RANK Ligand sRANKL His cyt-692 Recombinant Human Soluble RANK Ligand, His Tag sRANKL GST cyt-631 Recombinant Human Soluble RANK Ligand, GST Tag msRANKL cyt-320 Recombinant Mouse Soluble RANK Ligand sRANK Receptor cyt-734 Recombinant Human Soluble RANK Receptor mRELM a cyt-309 Recombinant Mouse RELM-alpha mRELM a His cyt-453 Recombinant Mouse RELM-alpha His Tag RELM b cyt-454 Recombinant Human RELM-beta mRELM b cyt-413 Recombinant Mouse RELM-beta mRELM g cyt-455 Recombinant Mouse RELM-Gamma Resistin cyt-456 Recombinant Human Resistin Resistin His cyt-256 Recombinant Human Resistin, His Tag Resistin Mutant cyt-585 Recombinant Human Resistin Mutant mResistin cyt-457 Recombinant Mouse Resistin rResistin cyt-458 Recombinant Rat Resistin RBP1 cyt-122 Recombinant Human Retinol Binding Protein-1 RBP4 cyt-535 Recombinant Human Retinol Binding Protein-4 RBP4 His cyt-555 Recombinant Human Retinol Binding Protein-4 His Tag RBP5 cyt-650 Recombinant Human Retinol Binding Protein-5 RBP7 cyt-023 Recombinant Human Retinol Binding Protein-7 SAA1 cyt-675 Recombinant Human Serum Amyloid A (APO-SAA1) rmSAA1 cyt-719 Recombinant Rhesus Macaque Serum Amyloid A (APO-SAA1) SAA4 cyt-002 Recombinant Human Serum Amyloid A4 SCF cyt-255 Recombinant Human Stem Cell Factor mSCF cyt-275 Recombinant Mouse Stem Cell Factor rSCF cyt-323 Recombinant Rat Stem Cell Factor SCF Sf9 cyt-421 Recombinant Human Stem Cell Factor, Sf9 SCF HEK cyt-111 Recombinant Human Stem Cell Factor, HEK k9SCF cyt-194 Recombinant Canine Stem Cell Factor SF20 cyt-622 Recombinant Human Chromosome 19 Open Reading Frame 10 mSF20 cyt-678 Recombinant Mouse Chromosome 19 Open Reading Frame 10 SPP1 cyt-635 Recombinant Human Osteopontin SPP1 HEK cyt-047 Recombinant Human Osteopontin, HEK TACI cyt-032 Recombinant Human Tumor Necrosis Factor Receptor 13B TAFA2 cyt-118 Recombinant Human Family with Sequence Similarity 19 Member A2 TDGF1 cyt-712 Recombinant Human Teratocarcinoma-Derived Growth Factor 1 TFF1 cyt-586 Recombinant Human Trefoil Factor-1 TFF1 His cyt-610 Recombinant Human Trefoil Factor-1 His Tag TFF2 cyt-612 Recombinant Human Trefoil Factor-2 TFF2 His cyt-611 Recombinant Human Trefoil Factor-2 His Tag TFF3 cyt-005 Recombinant Human Trefoil Factor-3 TFF3 His cyt-616 Recombinant Human Trefoil Factor-3 His Tag TGF b 1 cyt-716 Recombinant Human Transforming Growth Factor-Beta 1 TGF b 1 cyt-561 Human Transforming Growth Factor-Beta 1 TGF b 1 GST cyt-473 Recombinant Human Transforming Growth Factor-Beta 1, GST tag TGF b 1 His cyt-672 Recombinant Human Transforming Growth Factor-Beta 1 His Tag TGF b 1 (113 a.a.) cyt-679 Recombinant Human Transforming Growth Factor-Beta 1 (113 a.a.) TGF b 2 cyt-441 Recombinant Human Transforming Growth Factor-Beta 2 TGF b 2 HEK cyt-112 Recombinant Human Transforming Growth Factor-Beta 2, HEK TGF b 3 cyt-368 Recombinant Human Transforming Growth Factor-Beta 3 TGF b 3 CHO cyt-685 Recombinant Human Transforming Growth Factor-Beta 3, CHO TGF b 3 Plant cyt-588 Recombinant Human Transforming Growth Factor-Beta 3, Plant TGF b 3 HEK cyt-113 Recombinant Human Transforming Growth Factor-Beta 3, HEK TGF b 3 (207 a.a.) cyt-319 Recombinant Human Transforming Growth Factor-Beta 3 (644-850) mTGF b 3 cyt-143 Recombinant Mouse Transforming Growth Factor-Beta 3 4 1BBR cyt-463 Recombinant Human 4-1BB Receptor 4 1BBR, His cyt-137 Recombinant Human 4-1BB Receptor His Tag 4 1BBL cyt-149 Recombinant Human 4-1BB Ligand 4 1BBL, His cyt-649 Recombinant Human 4-1BB Ligand, His Tag TNF a cyt-223 Recombinant Human Tumor Necrosis Factor-alpha TNF a His cyt-494 Recombinant Human Tumor Necrosis Factor-alpha, His Tag TNF a HEK cyt-114 Recombinant Human Tumor Necrosis Factor-alpha, HEK mTNF a cyt-252 Recombinant Mouse Tumor Necrosis Factor-alpha rTNF a cyt-393 Recombinant Rat Tumor Necrosis Factor-alpha rpTNF a cyt-405 Recombinant Porcine Tumor Necrosis Factor-alpha raTNF a cyt-008 Recombinant Rabbit Tumor Necrosis Factor-alpha rCaTNF a cyt-140 Recombinant Canine Tumor Necrosis Factor-alpha rmTNF a cyt-737 Recombinant Rhesus Macaque Tumor Necrosis Factor-alpha TNF a Mutant cyt-384 Recombinant Human Tumor Necrosis Factor-alpha, Mutant TNF b cyt-224 Recombinant Human Tumor Necrosis Factor-beta TNF b His cyt-495 Recombinant Human Tumor Necrosis Factor-beta, His Tag TNFR2 cyt-674 Recombinant Human Tumor Necrosis Factor Receptor Type 2 TNFR2 Fc cyt-422 Recombinant Human Tumor Necrosis Factor Receptor 2 Fusion Protein TNFRSF17 cyt-598 Recombinant Human B-Cell Maturation Antigen TNFRSF17, His cyt-190 Recombinant Human B-Cell Maturation Antigen, His Tag TNFR cyt-707 Recombinant Human Tumor Necrosis Factor Receptor TNFR His cyt-673 Recombinant Human Tumor Necrosis Factor Receptor Type His Tag TNFSF12 cyt-699 Recombinant Human TNF Ligand Superfamily Member 12 TNFRSF10B cyt-069 Recombinant Human TNF Ligand Receptor Superfamily Member 10B TNFRSF12A cyt-043 Recombinant Human TNF Ligand Receptor Superfamily Member 12A TSLP cyt-572 Recombinant Human Thymic Stromal Lymphopoietin TSLPR cyt-742 Recombinant Human Thymic Stromal Lymphopoietin Receptor TPO cyt-302 Recombinant Human Thrombopoietin TPO CHO cyt-462 Recombinant Human Thrombopoietin, CHO TPO HEK cyt-115 Recombinant Human Thrombopoietin, HEK mTPO cyt-346 Recombinant Mouse Thrombopoietin TRAIL cyt-443 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L TRAIL (114-281 a.a.) cyt-546 Recombinant Human TNF-Related Apoptosis Inducing Ligand/Apo2L (114-281) ULBP1 cyt-166 Recombinant Human UL16 Binding Protein 1 Vaspin cyt-459 Recombinant Human Vaspin VEGF cyt-241 Recombinant Human Vascular Endothelial Growth Factor VEGF His cyt-496 Recombinant Human Vascular Endothelial Growth Factor, His Tag VEGF CHO cyt-260 Recombinant Human Vascular Endothelial Growth Factor, CHO VEGF HEK cyt-225 Recombinant Human Vascular Endothelial Growth Factor, HEK VEGF Yeast cyt-577 Recombinant Human Vascular Endothelial Growth Factor, Yeast VEGF (121a.a.) cyt-343 Recombinant Human Vascular Endothelial Growth Factor (121) VEGF (121a.a.) Sf9 cyt-200 Recombinant Human Vascular Endothelial Growth Factor (121), Sf9 VEGF (121a.a.) His cyt-619 Recombinant Human Vascular Endothelial Growth Factor (121), His Tag VEGF (121a.a.) HEK cyt-116 Recombinant Human Vascular Endothelial Growth Factor (121), HEK rmVEGF cyt-336 Recombinant Mouse Vascular Endothelial Growth Factor mVEGF Sf9 cyt-226 Recombinant Mouse Vascular Endothelial Growth Factor-Sf9 rmVEGF (121a.a.) cyt-574 Recombinant Mouse Vascular Endothelial Growth Factor (121) rmVEGF His cyt-680 Recombinant Mouse Vascular Endothelial Growth Factor, His Tag rVEGF cyt-392 Recombinant Rat Vascular Endothelial Growth Factor VEGFB cyt-628 Recombinant Human Vascular Endothelial Growth Factor B VEGF C cyt-527 Recombinant Human Vascular Endothelial Growth Factor Related Protein rVEGF C cyt-262 Recombinant Rat Vascular Endothelial Growth Factor Related Protein rVEGF C (152a.a.) cyt-284 Recombinant Rat Vascular Endothelial Growth Factor-C (152) VEGF D cyt-045 Recombinant Human Vascular Endothelial Growth Factor D VEGF E (Orf Virus) cyt-263 Recombinant Vascular Endothelial Growth Factor-E (Orf Virus) VEGI cyt-517 Recombinant Human Vascular Endothelial Growth Inhibitor VEGI His cyt-589 Recombinant Human Vascular Endothelial Growth Inhibitor, His Tag Visfatin cyt-318 Recombinant Human Visfatin Visfatin His cyt-563 Recombinant Human Visfatin, His Tag mVisfatin cyt-447 Recombinant Mouse Visfatin 重慶市華雅干細(xì)胞技術(shù)有限公司 : |